PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G03029.1.p
Common NameEUGRSUZ_G03029, LOC104454369
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 288aa    MW: 32301 Da    PI: 7.6843
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G03029.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.38.4e-091963346
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                      +WT+eE +++  a + + ++   +W++Ia+ +g  ++  ++ ++++ 
  Eucgr.G03029.1.p 19 SWTKEENKRFESALAIHDTDtpdRWDKIAAIVG--KSVRDVANKYRE 63
                      7*******************************8..899999999986 PP

2Myb_DNA-binding414.3e-13118162347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
  Eucgr.G03029.1.p 118 PWTQEEHRRFLMGLLKYGKGDWRNISRNFVVSKTPTQVASHAQKY 162
                       8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.441568IPR017884SANT domain
SMARTSM007173.0E-81667IPR001005SANT/Myb domain
SuperFamilySSF466892.58E-121871IPR009057Homeodomain-like
PfamPF002491.9E-71964IPR001005SANT/Myb domain
CDDcd001672.94E-61964No hitNo description
PROSITE profilePS5129419.139111167IPR017930Myb domain
SuperFamilySSF466891.0E-15113166IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-17114166IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-10115162IPR009057Homeodomain-like
SMARTSM007171.8E-10115165IPR001005SANT/Myb domain
CDDcd001671.88E-8118163No hitNo description
PfamPF002493.1E-10118162IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
METLYSPSCM SNSAWLSTSW TKEENKRFES ALAIHDTDTP DRWDKIAAIV GKSVRDVANK  60
YRELEEDVCE IEAGRDPIHG YLCSSFALES FDERDFDACR KKSSAGRGAD HERKKGVPWT  120
QEEHRRFLMG LLKYGKGDWR NISRNFVVSK TPTQVASHAQ KYFMRQVSGV KDKRRPSIHD  180
ITTVNLTDPA SSSENNRVSS LDQLNALSSQ QKLIGAPELA LDHSLPNYGG FMFFDSSHGH  240
LLMPDAYGFG LNGKRWQEKD NPDGVYPGAG FRSSLIGIHS SRHQIQG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00347DAPTransfer from AT3G11280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G03029.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010067497.10.0PREDICTED: transcription factor DIVARICATA-like
TrEMBLA0A059BHW70.0A0A059BHW7_EUCGR; Uncharacterized protein
STRINGVIT_13s0019g03370.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43402657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.21e-80MYB family protein